Recombinant Human FFAR2 Protein
Cat.No. : | FFAR2-4084H |
Product Overview : | Human FFAR2 full-length ORF (NP_005297.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | This gene encodes a member of the GP40 family of G protein-coupled receptors that are clustered together on chromosome 19. The encoded protein is a receptor for short chain free fatty acids and may be involved in the inflammatory response and in regulating lipid plasma levels. [provided by RefSeq |
Form : | Liquid |
Molecular Mass : | 37.1 kDa |
AA Sequence : | MLPDWKSSLILMAYIIIFLTGLPANLLALRAFVGRIRQPQPAPVHILLLSLTLADLLLLLLLPFKIIEAASNFRWYLPKVVCALTSFGFYSSIYCSTWLLAGISIERYLGVAFPVQYKLSRRPLYGVIAALVAWVMSFGHCTIVIIVQYLNTTEQVRSGNEITCYENFTDNQLDVVLPVRLELCLVLFFIPMAVTIFCYWRFVWIMLSQPLVGAQRRRRAVGLAVVTLLNFLVCFGPYNVSHLVGYHQRKSPWWRSIAVVFSSLNASLDPLLFYFSSSVVRRAFGRGLQVLRNQGSSLLGRRGKDTAEGTNEDRGVGQGEGMPSSDFTTE |
Applications : | Antibody Production Functional Study Compound Screening |
Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | FFAR2 free fatty acid receptor 2 [ Homo sapiens ] |
Official Symbol | FFAR2 |
Synonyms | FFA2R; GPR43; Free Fatty Acid Receptor 2; G-Protein Coupled Receptor 43; GPR43; Free Fatty Acid Activated Receptor 2; G Protein-Coupled Receptor 43; Fatty Acid Receptor 2; GPCR43; FFA2R; FFA2; free fatty acid receptor 2 |
Gene ID | 2867 |
mRNA Refseq | NM_005306 |
Protein Refseq | NP_005297 |
MIM | 603823 |
UniProt ID | O15552 |
◆ Recombinant Proteins | ||
FFAR2-4798HF | Recombinant Full Length Human FFAR2 Protein | +Inquiry |
FFAR2-3218M | Recombinant Mouse FFAR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ffar2-2183M | Recombinant Mouse Ffar2 Protein, His-tagged | +Inquiry |
FFAR2-4084H | Recombinant Human FFAR2 Protein | +Inquiry |
FFAR2-5828M | Recombinant Mouse FFAR2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FFAR2-6256HCL | Recombinant Human FFAR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FFAR2 Products
Required fields are marked with *
My Review for All FFAR2 Products
Required fields are marked with *
0
Inquiry Basket