Recombinant Human FFAR2 Protein

• Cat.No.: FFAR2-4084H
• Product Overview: Human FFAR2 full-length ORF (NP_005297.1) recombinant protein without tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Description: This gene encodes a member of the GP40 family of G protein-coupled receptors that are clustered together on chromosome 19. The encoded protein is a receptor for short chain free fatty acids and may be involved in the inflammatory response and in regulating lipid plasma levels. [provided by RefSeq
• Form: Liquid
• Molecular Mass: 37.1 kDa
• AA Sequence: MLPDWKSSLILMAYIIIFLTGLPANLLALRAFVGRIRQPQPAPVHILLLSLTLADLLLLLLLPFKIIEAASNFRWYLPKVVCALTSFGFYSSIYCSTWLLAGISIERYLGVAFPVQYKLSRRPLYGVIAALVAWVMSFGHCTIVIIVQYLNTTEQVRSGNEITCYENFTDNQLDVVLPVRLELCLVLFFIPMAVTIFCYWRFVWIMLSQPLVGAQRRRRAVGLAVVTLLNFLVCFGPYNVSHLVGYHQRKSPWWRSIAVVFSSLNASLDPLLFYFSSSVVRRAFGRGLQVLRNQGSSLLGRRGKDTAEGTNEDRGVGQGEGMPSSDFTTE
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Usage: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: FFAR2 free fatty acid receptor 2 [ Homo sapiens ]
• Official Symbol: FFAR2
• Synonyms: FFA2R; GPR43; Free Fatty Acid Receptor 2; G-Protein Coupled Receptor 43; GPR43; Free Fatty Acid Activated Receptor 2; G Protein-Coupled Receptor 43; Fatty Acid Receptor 2; GPCR43; FFA2R; FFA2; free fatty acid receptor 2
• Gene ID: 2867
• mRNA Refseq: NM_005306
• Protein Refseq: NP_005297
• MIM: 603823
• UniProt ID: O15552