Recombinant Human FDPS
Cat.No. : | FDPS-28480TH |
Product Overview : | Recombinant fragment corresponding to amino acids 320-419 of Human FDPS with N terminal proprietary tag; predicted MW: 36.63 kDa, inclusive of tag. P14324, |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene encodes an enzyme that catalyzes the production of geranyl pyrophosphate and farnesyl pyrophosphate from isopentenyl pyrophosphate and dimethylallyl pyrophosphate. The resulting product, farnesyl pyrophosphate, is a key intermediate in cholesterol and sterol biosynthesis, a substrate for protein farnesylation and geranylgeranylation, and a ligand or agonist for certain hormone receptors and growth receptors. Drugs that inhibit this enzyme prevent the post-translational modifications of small GTPases and have been used to treat diseases related to bone resorption. Multiple pseudogenes have been found on chromosomes 1, 7, 14, 15, 21 and X. Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKEAEKVARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK |
Sequence Similarities : | Belongs to the FPP/GGPP synthase family. |
Gene Name | FDPS farnesyl diphosphate synthase [ Homo sapiens ] |
Official Symbol | FDPS |
Synonyms | FDPS; farnesyl diphosphate synthase; farnesyl pyrophosphate synthase; farnesyl pyrophosphate synthetase; dimethylallyltranstransferase; geranyltranstransferase; |
Gene ID | 2224 |
mRNA Refseq | NM_001135821 |
Protein Refseq | NP_001129293 |
MIM | 134629 |
Uniprot ID | P14324 |
Chromosome Location | 1q22 |
Pathway | Cholesterol Biosynthesis, organism-specific biosystem; Cholesterol biosynthesis, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; Influenza A, organism-specific biosystem; |
Function | dimethylallyltranstransferase activity; geranyltranstransferase activity; metal ion binding; transferase activity; |
◆ Recombinant Proteins | ||
FDPS-2895H | Recombinant Human FDPS protein, His-SUMO-tagged | +Inquiry |
FDPS-1966R | Recombinant Rat FDPS Protein, His (Fc)-Avi-tagged | +Inquiry |
Fdps-1001M | Recombinant Mouse Fdps protein, His-tagged | +Inquiry |
FDPS-28480TH | Recombinant Human FDPS | +Inquiry |
FDPS-3202M | Recombinant Mouse FDPS Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FDPS-615HCL | Recombinant Human FDPS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FDPS Products
Required fields are marked with *
My Review for All FDPS Products
Required fields are marked with *
0
Inquiry Basket