Recombinant Human FDCSP Protein, GST-tagged

• Cat.No.: FDCSP-4056H
• Product Overview: Human FDCSP full-length ORF (AAH62213.1, 1 a.a. - 85 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: FDCSP is expressed by follicular dendritic cells (FDCs) and activated leukocytes during ongoing immune responses.[supplied by OMIM
• Molecular Mass: 35.75 kDa
• AA Sequence: MKKVLLLITAILAVAVGFPVSQDQEREKRSISDSDELASGFFVFPYPYPFRPLPPIPFPRFPWFRRNFPIPIPESAPTTPLPSEK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FDCSP follicular dendritic cell secreted protein [ Homo sapiens ]
• Official Symbol: FDCSP
• Synonyms: C4orf7; FDC-SP; Follicular Dendritic Cell Secreted Protein; FDC Secreted Protein; Follicular Dendritic Cell Secreted Peptide; Chromosome 4 Open Reading Frame; FDCSP; follicular dendritic cell secreted protein
• Gene ID: 260436
• mRNA Refseq: NM_152997
• Protein Refseq: NP_694542
• MIM: 607241
• UniProt ID: Q8NFU4