Recombinant Human FCRLA protein, His-tagged

• Cat.No.: FCRLA-3756H
• Product Overview: Recombinant Human FCRLA protein(275-376 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 275-376 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: IRVQGASSSAAPPTLNPAPQKSAAPGTAPEEAPGPLPPPPTPSSEDPGFSSPLGMPDPHLYHQMGLLLKHMQDVRVLLGHLLMELRELSGHQKPGTTKATAE
• Purity: 98%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: FCRLA Fc receptor-like A [ Homo sapiens ]
• Official Symbol: FCRLA
• Synonyms: FCRLA; Fc receptor-like A; Fc receptor like and mucin like 1 , FCRLM1; FCRL; FCRLa; FCRLb; FCRLc1; FCRLc2; FCRLd; FCRLe; FCRLX; FREB; MGC4595; fc receptor-like protein; Fc receptor related protein X; fc receptor-related protein X; Fc receptor-like and mucin-like 1; fc receptor homolog expressed in B-cells; fc receptor-like and mucin-like protein 1; Fc receptor homolog expressed in B cells (FREB); FCRX; FCRL1; FCRLM1; RP11-474I16.5
• Gene ID: 84824
• mRNA Refseq: NM_001184866
• Protein Refseq: NP_001171795
• MIM: 606891
• UniProt ID: Q7L513