Recombinant Human FCRL6 Protein, His-tagged

• Cat.No.: FCRL6-1211H
• Product Overview: Recombinant Human FCRL6 Protein (20-307aa) was expressed in E. coli with N-terminal His tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 20-307 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 35.7 kDa
• AA Sequence: LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVLFTPASNW
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: FCRL6 Fc receptor like 6 [ Homo sapiens (human) ]
• Official Symbol: FCRL6
• Synonyms: FcRH6; FCRL6; Fc receptor-like protein 6; FcR-like protein 6; IFGP6; FcRH6; Fc receptor homolog 6
• Gene ID: 343413
• mRNA Refseq: NM_001004310.2
• Protein Refseq: NP_001004310.2
• MIM: 613562
• UniProt ID: Q6DN72