Recombinant Human FCGRT protein, His-tagged

• Cat.No.: FCGRT-3057H
• Product Overview: Recombinant Human FCGRT protein(24-297 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 24-297 aa
• AA Sequence: AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSS
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: FCGRT Fc fragment of IgG, receptor, transporter, alpha [ Homo sapiens ]
• Official Symbol: FCGRT
• Synonyms: FCGRT; Fc fragment of IgG, receptor, transporter, alpha; IgG receptor FcRn large subunit p51; alpha chain; FCRN; FcRn alpha chain; neonatal Fc receptor; neonatal Fc-receptor for Ig; IgG Fc fragment receptor transporter alpha chain; immunoglobulin receptor, intestinal, heavy chain; major histocompatibility complex class I-like Fc receptor; alpha-chain
• Gene ID: 2217
• mRNA Refseq: NM_001136019
• Protein Refseq: NP_001129491
• MIM: 601437
• UniProt ID: P55899