Recombinant Human FCGR3B protein(18-125aa), His-GST&Myc-tagged

• Cat.No.: FCGR3B-309H
• Product Overview: Recombinant Human FCGR3B protein(O75015)(18-125aa), fused with N-terminal His and GST tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST&His&Myc
• Protein Length: 18-125aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 47.5 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: MRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIH

Gene Information

• Gene Name: FCGR3B Fc fragment of IgG, low affinity IIIb, receptor (CD16b) [ Homo sapiens ]
• Official Symbol: FCGR3B
• Synonyms: FCGR3B; Fc fragment of IgG, low affinity IIIb, receptor (CD16b); Fc fragment of IgG, low affinity IIIb, receptor for (CD16) , FCG3, FCGR3; low affinity immunoglobulin gamma Fc region receptor III-B; CD16; CD16b; fc-gamma RIII; fc-gamma RIIIb; fc-gamma RIII-beta; igG Fc receptor III-1; Fc-gamma receptor IIIb (CD 16); Fc fragment of IgG, low affinity IIIb, receptor for (CD16); FCG3; FCGR3; FCR-10; FCRIII; FCRIIIb
• Gene ID: 2215
• mRNA Refseq: NM_000570
• Protein Refseq: NP_000561
• MIM: 610665
• UniProt ID: O75015