Recombinant Human FCGR3A protein, His&Myc-tagged
Cat.No. : | FCGR3A-5743H |
Product Overview : | Recombinant Human FCGR3A protein(P08637)(49-184aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 49-184aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 50.7 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | GAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSE |
Gene Name | FCGR3A Fc fragment of IgG, low affinity IIIa, receptor (CD16a) [ Homo sapiens ] |
Official Symbol | FCGR3A |
Synonyms | FCGR3A; Fc fragment of IgG, low affinity IIIa, receptor (CD16a); Fc fragment of IgG, low affinity IIIa, receptor for (CD16) , FCG3, FCGR3; low affinity immunoglobulin gamma Fc region receptor III-A; CD16; CD16a; FcgammaRIIIA; CD16a antigen; fc-gamma RIII; Fc-gamma RIIIa; Fc-gamma RIII-alpha; igG Fc receptor III-2; Fc gamma receptor III-A; Fc-gamma receptor IIIb (CD16); neutrophil-specific antigen NA; Fc-gamma receptor III-2 (CD 16); immunoglobulin G Fc receptor III; Fc fragment of IgG, low affinity III, receptor for (CD16); FCG3; CD16A; FCGR3; IGFR3; FCR-10; FCRIII; FCGRIII; FCRIIIA; |
Gene ID | 2214 |
mRNA Refseq | NM_000569 |
Protein Refseq | NP_000560 |
MIM | 146740 |
UniProt ID | P08637 |
◆ Recombinant Proteins | ||
FCGR3A-100H | Active Recombinant Human FCGR3A protein(Met1-Gln208,176F), His-Avi-tagged | +Inquiry |
FCGR3A-3996H | Recombinant Human FCGR3A Protein, GST-tagged | +Inquiry |
FCGR3A-309H | Active Recombinant Human FCGR3A protein, His-tagged | +Inquiry |
FCGR3A-1416H | Active Recombinant Human FCGR3A protein(F176), His-Avi-tagged, Biotinylated | +Inquiry |
FCGR3A-924H | Recombinant Human FCGR3A Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCGR3A-1999HCL | Recombinant Human FCGR3A cell lysate | +Inquiry |
FCGR3A-1969RCL | Recombinant Rat FCGR3A cell lysate | +Inquiry |
FCGR3A-001HCL | Recombinant Human FCGR3A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FCGR3A Products
Required fields are marked with *
My Review for All FCGR3A Products
Required fields are marked with *
0
Inquiry Basket