Recombinant Human FCGR3A Protein, GST-tagged

• Cat.No.: FCGR3A-3996H
• Product Overview: Human FCGR3A full-length ORF ( AAH17865.1, 17 a.a. - 254 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a receptor for the Fc portion of immunoglobulin G, and it is involved in the removal of antigen-antibody complexes from the circulation, as well as other other antibody-dependent responses. This gene (FCGR3A) is highly similar to another nearby gene (FCGR3B) located on chromosome 1. The receptor encoded by this gene is expressed on natural killer (NK) cells as an integral membrane glycoprotein anchored through a transmembrane peptide, whereas FCGR3B is expressed on polymorphonuclear neutrophils (PMN) where the receptor is anchored through a phosphatidylinositol (PI) linkage. Mutations in this gene have been linked to susceptibility to recurrent viral infections, susceptibility to systemic lupus erythematosus, and alloimmune neonatal neutropenia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
• Molecular Mass: 51.92 kDa
• AA Sequence: GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLYFSVKTNIRSSTRDWKDHKFKWRKDPQDK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FCGR3A Fc fragment of IgG, low affinity IIIa, receptor (CD16a) [ Homo sapiens ]
• Official Symbol: FCGR3A
• Synonyms: FCGR3A; Fc fragment of IgG, low affinity IIIa, receptor (CD16a); Fc fragment of IgG, low affinity IIIa, receptor for (CD16) , FCG3, FCGR3; low affinity immunoglobulin gamma Fc region receptor III-A; CD16; CD16a; FcgammaRIIIA; CD16a antigen; fc-gamma RIII; Fc-gamma RIIIa; Fc-gamma RIII-alpha; igG Fc receptor III-2; Fc gamma receptor III-A; Fc-gamma receptor IIIb (CD16); neutrophil-specific antigen NA; Fc-gamma receptor III-2 (CD 16); immunoglobulin G Fc receptor III; Fc fragment of IgG, low affinity III, receptor for (CD16); FCG3; CD16A; FCGR3; IGFR3; FCR-10; FCRIII; FCGRIII; FCRIIIA
• Gene ID: 2214
• mRNA Refseq: NM_000569
• Protein Refseq: NP_000560
• MIM: 146740
• UniProt ID: P08637