Recombinant Human FCGR2B protein, Myc/DDK-tagged
Cat.No. : | FCGR2B-01H |
Product Overview : | Recombinant Human FCGR2B protein, fused to Myc/DDK-tagged, was expressed in HEK293T. Protein Families: ES Cell Differentiation/IPS, Transmembrane. Protein Pathways: B cell receptor signaling pathway, Fc gamma R-mediated phagocytosis, Systemic lupus erythematosus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a low affinity receptor for the Fc region of immunoglobulin gamma complexes. The encoded protein is involved in the phagocytosis of immune complexes and in the regulation of antibody production by B-cells. Variations in this gene may increase susceptibilty to systemic lupus erythematosus (SLE). Several transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Molecular Mass : | 31.7 kDa |
AA Sequence : | myc-FLAG tag |
Product-Related Proteins : | TA50011-100 LC424200 TA358460 RC219569 |
Purity : | > 80% |
Usage : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL |
Gene Name | FCGR2B Fc gamma receptor IIb [ Homo sapiens (human) ] |
Official Symbol | FCGR2B |
Synonyms | CD32; CD32B; FCG2; FCGR2; FCGR2C; FcRII-c; IGFR2 |
Gene ID | 2213 |
mRNA Refseq | NM_001002273 |
Protein Refseq | NP_001002273 |
MIM | 604590 |
UniProt ID | P31994 |
◆ Recombinant Proteins | ||
FCGR2B-1676R | Recombinant Rhesus monkey FCGR2B Protein, His-tagged | +Inquiry |
FCGR2B-1439R | Active Recombinant Rat FCGR2B protein, His-tagged | +Inquiry |
FCGR2B-3789H | Recombinant Human FCGR2B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FCGR2B-01H | Recombinant Human FCGR2B protein, Myc/DDK-tagged | +Inquiry |
FCGR2B-1441M | Active Recombinant Mouse FCGR2B protein, Avi-His-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCGR2B-1942RCL | Recombinant Rat FCGR2B cell lysate | +Inquiry |
FCGR2B-001HCL | Recombinant Human FCGR2B cell lysate | +Inquiry |
FCGR2B-1994CCL | Recombinant Cynomolgus FCGR2B cell lysate | +Inquiry |
FCGR2B-1988HCL | Recombinant Human FCGR2B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FCGR2B Products
Required fields are marked with *
My Review for All FCGR2B Products
Required fields are marked with *
0
Inquiry Basket