Recombinant Human FCGR2B Protein, 46-217aa, C-His tagged

• Cat.No.: FCGR2B-05H
• Product Overview: Recombinant human Fc gamma RIIB/CD32b, 46-217aa, fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 46-217aa
• Description: Fc gamma RIIB/CD32b, also known as FCGR2B, belongs to the Ig superfamily. It is a low-affinity receptor for the Fc region of immunoglobulins gamma that are complexed or aggregated. It participates in various effector and regulatory functions, such as phagocytosis of immune complexes and modulation of antibody production by B cells. Fc gamma RIIB/CD32b is expressed on B cells, monocytes, dendritic cells, neutrophils, mast cells, and basophils. When Fc gamma RIIB is ligated, it inhibits B cell expansion, plasma cell differentiation, production of autoimmune rheumatoid factors, and down-regulates TLR4 with reduced LPS responsiveness.
• Form: Liquid
• Bio-activity: Measured by its binding ability in a functional ELISA with Human IgG1 Fc.
• Molecular Mass: 20.1kDa (178aa)
• AA Sequence: APPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAP
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE, Bioactivity
• Notes: For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 1 mg/mL (determined by Absorbance at 280nm)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
• References: 1. Van de Winkel, J. and P. Capes (1993) Immunol. Today 14:215-221.
  2.Raghaven, M. and P. Bjorkman (1996) Annu. Rev. Cell Dev. Biol. 12:181-220.
  3. Ravetch, J. and S. Bolland (2001) Annu. Rev. Immunol. 19:275-290.

Gene Information

• Gene Name: FCGR2B Fc fragment of IgG, low affinity IIb, receptor (CD32) [ Homo sapiens (human) ]
• Official Symbol: FCGR2B
• Synonyms: FCGR2B; Fc fragment of IgG, low affinity IIb, receptor (CD32); Fc fragment of IgG, low affinity IIb, receptor for (CD32) , FCG2, FCGR2; low affinity immunoglobulin gamma Fc region receptor II-b; CD32; CD32B; CDw32; fcRII-b; Fc gamma RIIb; fc-gamma-RIIb; fc-gamma RII-b; igG Fc receptor II-b; Fc fragment of IgG, low affinity II, receptor for (CD32); Fc fragment of IgG, low affinity IIb, receptor for (CD32); FCG2; FCGR2; IGFR2
• Gene ID: 2213
• mRNA Refseq: NM_001002274
• Protein Refseq: NP_001002274
• MIM: 604590
• UniProt ID: P31994