Recombinant Human FCGR2A Protein, His-tagged

Cat.No. : FCGR2A-301H
Product Overview : Recombinant human FCGR2A protein with His tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 317
Description : This gene encodes one member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Alternative splicing results in multiple transcript variants.
Form : Lyophilized
Molecular Mass : 31 kDa
AA Sequence : MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGIIVAVVIATAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name FCGR2A Fc fragment of IgG, low affinity IIa, receptor (CD32) [ Homo sapiens (human) ]
Official Symbol FCGR2A
Synonyms FCGR2A; Fc fragment of IgG, low affinity IIa, receptor (CD32); Fc fragment of IgG, low affinity IIa, receptor for (CD32) , FCG2, FCGR2, FCGR2A1; low affinity immunoglobulin gamma Fc region receptor II-a; CD32; CD32A; CDw32; IGFR2; Immunoglobulin G Fc receptor II; fcRII-a; fc-gamma-RIIa; fc-gamma RII-a; igG Fc receptor II-a; FCG2; FcGR; FCGR2; FCGR2A1; MGC23887; MGC30032;
Gene ID 2212
mRNA Refseq NM_001136219
Protein Refseq NP_001129691
MIM 146790
UniProt ID P12318

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FCGR2A Products

Required fields are marked with *

My Review for All FCGR2A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon