Recombinant Human FCGR2A Protein
Cat.No. : | FCGR2A-3990H |
Product Overview : | Human FCGR2A full-length ORF (AAH20823.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | This gene encodes one member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2008] |
Form : | Liquid |
Molecular Mass : | 34.9 kDa |
AA Sequence : | MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGVIVAVVIATAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN |
Applications : | Antibody Production Functional Study Compound Screening |
Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH 8.0 containing 2% glycerol. |
Gene Name | FCGR2A Fc fragment of IgG, low affinity IIa, receptor (CD32) [ Homo sapiens ] |
Official Symbol | FCGR2A |
Synonyms | FCGR2A; Fc fragment of IgG, low affinity IIa, receptor (CD32); Fc fragment of IgG, low affinity IIa, receptor for (CD32) , FCG2, FCGR2, FCGR2A1; low affinity immunoglobulin gamma Fc region receptor II-a; CD32; CD32A; CDw32; IGFR2; Immunoglobulin G Fc receptor II; fcRII-a; fc-gamma-RIIa; fc-gamma RII-a; igG Fc receptor II-a; FCG2; FcGR; FCGR2; FCGR2A1; MGC23887; MGC30032; |
Gene ID | 2212 |
mRNA Refseq | NM_001136219 |
Protein Refseq | NP_001129691 |
MIM | 146790 |
UniProt ID | P12318 |
◆ Recombinant Proteins | ||
FCGR2A-1472C | Recombinant Cynomolgus FCGR2A protein, His-tagged | +Inquiry |
FCGR2A-4108C | Recombinant Cynomolgus Fc Fragment Of LgG, Low Affinity LIa, Receptor (CD32), AVI-tagged | +Inquiry |
FCGR2A-568C | Active Recombinant Cynomolgus FCGR2A protein, His-Avi-tagged | +Inquiry |
FCGR2A-3992H | Recombinant Human FCGR2A Protein, GST-tagged | +Inquiry |
FCGR2A-513HB | Recombinant Human FCGR2A protein(F176), His-Avi-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCGR2A-001HCL | Recombinant Human FCGR2A cell lysate | +Inquiry |
FCGR2A-1926CCL | Recombinant Cynomolgus FCGR2A cell lysate | +Inquiry |
FCGR2A-1996HCL | Recombinant Human FCGR2A cell lysate | +Inquiry |
FCGR2A-678HCL | Recombinant Human FCGR2A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FCGR2A Products
Required fields are marked with *
My Review for All FCGR2A Products
Required fields are marked with *
0
Inquiry Basket