Recombinant Human FCER2 protein

• Cat.No.: FCER2-27253TH
• Product Overview: Recombinant Human FCER2 protein was expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 172
• Description: The protein encoded by this gene is a B-cell specific antigen, and a low-affinity receptor for IgE. It has essential roles in B cell growth and differentiation, and the regulation of IgE production. This protein also exists as a soluble secreted form, then functioning as a potent mitogenic growth factor. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
• Bio-activity: Fully biologically active when compared to standard. The ED50 determined by its ability to induce TNF-alpha production by human PBMCs.
• Molecular Mass: Approximately 19.2 kDa, a single non-glycosylated polypeptide chain containing 172 amino acids.
• AA Sequence: MELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
• Endotoxin: Less than 0.1 EU/µg of rHusCD23 as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: FCER2
• Official Symbol: FCER2
• Synonyms: FCER2; Fc fragment of IgE, low affinity II, receptor for (CD23); CD23A, Fc fragment of IgE, low affinity II, receptor for (CD23A) , FCE2; low affinity immunoglobulin epsilon Fc receptor; CD23; CLEC4J; BLAST-2; CD23 antigen; fc-epsilon-RII; lymphocyte IgE receptor; immunoglobulin E-binding factor; C-type lectin domain family 4, member J; FCE2; CD23A; IGEBF
• Gene ID: 2208
• mRNA Refseq: NM_001207019
• Protein Refseq: NP_001193948
• MIM: 151445
• UniProt ID: P06734