Recombinant Human FCER1G Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: FCER1G-3843H
• Product Overview: FCER1G MS Standard C13 and N15-labeled recombinant protein (NP_004097) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: The high affinity IgE receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha, 1 beta, and 2 gamma chains. The gamma chains are also subunits of other Fc receptors.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 9.67 kDa
• AA Sequence: MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: FCER1G Fc fragment of IgE receptor Ig [ Homo sapiens (human) ]
• Official Symbol: FCER1G
• Synonyms: FCER1G; Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide; high affinity immunoglobulin epsilon receptor subunit gamma; fcRgamma; fceRI gamma; fc-epsilon RI-gamma; Fc receptor gamma-chain; immunoglobulin E receptor, high affinity, gamma chain; FCRG
• Gene ID: 2207
• mRNA Refseq: NM_004106
• Protein Refseq: NP_004097
• MIM: 147139
• UniProt ID: P30273