Recombinant Human FCER1G protein, GST-tagged

• Cat.No.: FCER1G-2890H
• Product Overview: Recombinant Human FCER1G protein(P30273)(19-86aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 34.8 kDa
• Protein length: 19-86aa
• AA Sequence: LGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: FCER1G Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide [ Homo sapiens ]
• Official Symbol: FCER1G
• Synonyms: FCER1G; Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide; high affinity immunoglobulin epsilon receptor subunit gamma; fcRgamma; fceRI gamma; fc-epsilon RI-gamma; Fc receptor gamma-chain; immunoglobulin E receptor, high affinity, gamma chain; FCRG
• Gene ID: 2207
• mRNA Refseq: NM_004106
• Protein Refseq: NP_004097
• MIM: 147139
• UniProt ID: P30273