Recombinant Human FCER1A, GST-tagged
Cat.No. : | FCER1A-28166TH |
Product Overview : | Recombinant Human FCER1A (1 a.a. - 257 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The immunoglobulin epsilon receptor (IgE receptor) is the initiator of the allergic response. When two or more high-affinity IgE receptors are brought together by allergen-bound IgE molecules, mediators such as histamine that are responsible for allergy symptoms are released. This receptor is comprised of an alpha subunit, a beta subunit, and two gamma subunits. The protein encoded by this gene represents the alpha subunit. |
Molecular Mass : | 54.01 kDa |
AA Sequence : | MAPAMESPTLLCVALLFFAPDGVLAVPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETN SSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGE ALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQFFIPLLVVILFAVDTGLFIS TQQQVTFLLKIKRTRKGFRLLNPHPKPNPKNN |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FCER1A Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide [ Homo sapiens (human) ] |
Official Symbol | FCER1A |
Synonyms | FCER1A; FCE1A; FcERI; Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide; high affinity immunoglobulin epsilon receptor subunit alpha; Fc-epsilon RI-alpha; Fc epsilon RI alpha-chain; igE Fc receptor subunit alpha; Fc IgE receptor, alpha polypeptide; high affinity immunoglobulin epsilon receptor alpha-subunit; immunoglobulin E receptor, high-affinity, of mast cells, alpha polypeptide |
Gene ID | 2205 |
mRNA Refseq | NM_002001 |
Protein Refseq | NP_001992 |
MIM | 147140 |
UniProt ID | P12319 |
Chromosome Location | 1q23 |
Pathway | Asthma; Fc epsilon RI signaling pathway; Fc epsilon receptor (FCERI) signaling |
Function | IgE binding; IgE receptor activity |
◆ Recombinant Proteins | ||
FCER1A-204H | Recombinant Human FCER1A, His-tagged | +Inquiry |
FCER1A-1961R | Recombinant Rat FCER1A Protein, His (Fc)-Avi-tagged | +Inquiry |
FCER1A-193H | Active Recombinant Human FCER1A, His-tagged, Biotinylated | +Inquiry |
FCER1A-237H | Recombinant Human FCER1A | +Inquiry |
RFL15030RF | Recombinant Full Length Rat High Affinity Immunoglobulin Epsilon Receptor Subunit Alpha(Fcer1A) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCER1A-1389MCL | Recombinant Mouse FCER1A cell lysate | +Inquiry |
FCER1A-1394HCL | Recombinant Human FCER1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FCER1A Products
Required fields are marked with *
My Review for All FCER1A Products
Required fields are marked with *
0
Inquiry Basket