Recombinant Human FCAR Protein, His-tagged

• Cat.No.: FCAR-030H
• Product Overview: Recombinant Human FCAR Protein with His tag was expressed in E. coli.

Specification

• Description: Fc (Ig constant fragment) receptors ensure protection of the host against foreign antigens, such as microorganisms and pathogens, by removing Ig-coated antigen complexes from circulation. Fc receptors are present on lymphoid and myeloid derivatives, where they mediate endocytosis of Ig-antigen complexes, antibody production in B cells through T cell antigen presentation, cytotoxicity and the release of cytokines and reactive oxygen species. CD89, also known as Immunoglobulin α Fc receptor (Fc α RI), is a glycoprotein that is expressed on the surface of neutrophils, monocytes, macrophages and eosinophils and is a potent cytotoxic trigger molecule. CD89 specifically interacts with aggregated IgAs, not IgG. Cytokines can initiate a high-binding state for CD89 through a mechanism that involves the intracellular C-terminus of CD89. Polymorphisms within the gene encoding CD89 may be associated with susceptibility to IgA nephropathy, a form of glomerulonephritis characterized by IgA antibody deposition in the kidney glomerulus.
• Source: E. coli
• Species: Human
• Tag: His
• Molecular Mass: ~23 kDa
• AA Sequence: QEGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSADRGLVLMPGENISLTCSSAHIPFDRFSLAKEGELSLPQHQSGEHPANFSLGPVDLNVSGIYRCYGWYNRSPYLWSFPSNALELVVTDSIHQDYTTQN
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Notes: For research use only, not for use in diagnostic procedure.
• Storage: Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
• Storage Buffer: PBS, 4M Urea, pH7.4

Gene Information

• Gene Name: FCAR Fc fragment of IgA, receptor for [ Homo sapiens (human) ]
• Official Symbol: FCAR
• Synonyms: FCAR; Fc fragment of IgA, receptor for; immunoglobulin alpha Fc receptor; CD89; IgA Fc receptor; Fc alpha receptor
• Gene ID: 2204
• mRNA Refseq: NM_002000
• Protein Refseq: NP_001991
• MIM: 147045
• UniProt ID: P24071