Recombinant Human FBXW11 protein, GST-tagged

• Cat.No.: FBXW11-12808H
• Product Overview: Recombinant Human FBXW11 protein(216-529 aa), fused with GST tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• Protein length: 216-529 aa
• AA Sequence: NLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYISR
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: FBXW11 F-box and WD repeat domain containing 11 [ Homo sapiens ]
• Official Symbol: FBXW11
• Synonyms: FBXW11; F-box and WD repeat domain containing 11; F box and WD 40 domain protein 1B , F box and WD 40 domain protein 11 , FBXW1B; F-box/WD repeat-containing protein 11; BTRC2; BTRCP2; Fbw1b; Fbw11; Hos; KIAA0696; F-box protein Fbw1b; homologous to Slimb protein; F-box and WD-40 domain protein 11; F-box and WD-40 domain protein 1B; F-box/WD repeat-containing protein 1B; F-box and WD repeats protein beta-TrCP2; beta-transducin repeat-containing protein 2; FBW1B; FBXW1B
• Gene ID: 23291
• mRNA Refseq: NM_012300
• Protein Refseq: NP_036432
• MIM: 605651
• UniProt ID: Q9UKB1