Recombinant Human FBXW11 Protein
Cat.No. : | FBXW11-14H |
Product Overview : | Recombinant Human FBXW11 Protein without tag was expressed in E. coli. |
Availability | March 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbws class and, in addition to an F-box, contains multiple WD40 repeats. This gene contains at least 14 exons, and its alternative splicing generates 3 transcript variants diverging at the presence/absence of two alternate exons. |
Molecular Mass : | The protein has a calculated MW of 62 kDa. |
AA Sequence : | MEPDSVIEDKTIELMCSVPRSLWLGCANLVESMCALSCLQSMPSVRCLQISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPEQGLDHIAENILSYLDARSLCAAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKGLSERRGWDQYLFKNRPTDGPPNSFYRSLYPKIIQDIETIESNWRCGRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYISR |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.2 mg/mL by BCA |
Storage Buffer : | 25mM Tris, 150 mM NaCl, 500 mM Arginine, pH8.5 |
Gene Name | FBXW11 F-box and WD repeat domain containing 11 [ Homo sapiens ] |
Official Symbol | FBXW11 |
Synonyms | FBXW11; F-box and WD repeat domain containing 11; F box and WD 40 domain protein 1B, F box and WD 40 domain protein 11, FBXW1B; F-box/WD repeat-containing protein 11; BTRC2; BTRCP2; Fbw1b; Fbw11; Hos; KIAA0696; F-box protein Fbw1b; homologous to Slimb protein; F-box and WD-40 domain protein 11; F-box and WD-40 domain protein 1B; F-box/WD repeat-containing protein 1B; F-box and WD repeats protein beta-TrCP2; beta-transducin repeat-containing protein 2; FBW1B; FBXW1B; |
Gene ID | 23291 |
mRNA Refseq | NM_012300 |
Protein Refseq | NP_036432 |
MIM | 605651 |
UniProt ID | Q9UKB1 |
◆ Recombinant Proteins | ||
FBXW11-4700HF | Recombinant Full Length Human FBXW11 Protein, GST-tagged | +Inquiry |
FBXW11-6433H | Recombinant Human FBXW11 protein, His&Myc-tagged | +Inquiry |
Fbxw11-230M | Recombinant Mouse Fbxw11 Protein, MYC/DDK-tagged | +Inquiry |
FBXW11-3327C | Recombinant Chicken FBXW11 | +Inquiry |
FBXW11-1494R | Recombinant Rhesus Macaque FBXW11 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FBXW11-6286HCL | Recombinant Human FBXW11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FBXW11 Products
Required fields are marked with *
My Review for All FBXW11 Products
Required fields are marked with *
0
Inquiry Basket