Recombinant Human FBXW11 Protein

Cat.No. : FBXW11-14H
Product Overview : Recombinant Human FBXW11 Protein without tag was expressed in E. coli.
Availability March 13, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbws class and, in addition to an F-box, contains multiple WD40 repeats. This gene contains at least 14 exons, and its alternative splicing generates 3 transcript variants diverging at the presence/absence of two alternate exons.
Molecular Mass : The protein has a calculated MW of 62 kDa.
AA Sequence : MEPDSVIEDKTIELMCSVPRSLWLGCANLVESMCALSCLQSMPSVRCLQISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPEQGLDHIAENILSYLDARSLCAAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKGLSERRGWDQYLFKNRPTDGPPNSFYRSLYPKIIQDIETIESNWRCGRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYISR
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.2 mg/mL by BCA
Storage Buffer : 25mM Tris, 150 mM NaCl, 500 mM Arginine, pH8.5
Gene Name FBXW11 F-box and WD repeat domain containing 11 [ Homo sapiens ]
Official Symbol FBXW11
Synonyms FBXW11; F-box and WD repeat domain containing 11; F box and WD 40 domain protein 1B, F box and WD 40 domain protein 11, FBXW1B; F-box/WD repeat-containing protein 11; BTRC2; BTRCP2; Fbw1b; Fbw11; Hos; KIAA0696; F-box protein Fbw1b; homologous to Slimb protein; F-box and WD-40 domain protein 11; F-box and WD-40 domain protein 1B; F-box/WD repeat-containing protein 1B; F-box and WD repeats protein beta-TrCP2; beta-transducin repeat-containing protein 2; FBW1B; FBXW1B;
Gene ID 23291
mRNA Refseq NM_012300
Protein Refseq NP_036432
MIM 605651
UniProt ID Q9UKB1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FBXW11 Products

Required fields are marked with *

My Review for All FBXW11 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon