Recombinant Human FBXO47 Protein, GST-tagged

• Cat.No.: FBXO47-3956H
• Product Overview: Human FBXO47 partial ORF ( NP_001008777, 1 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: FBXO47 (F-Box Protein 47) is a Protein Coding gene. Diseases associated with FBXO47 include Renal Cell Carcinoma, Papillary.
• Molecular Mass: 36.63 kDa
• AA Sequence: MASRINTNFTLIPNQKLRRSNRQTSCYSKTLGSGFQPISTFGNFKALPLEIFQIILKYLSVKDISMLSMVSKTVSQHIINYISTSSGSKRLLLQDFHNL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FBXO47 F-box protein 47 [ Homo sapiens (human) ]
• Official Symbol: FBXO47
• Synonyms: FBXO47; F-box protein 47; F-Box Protein 47; F-box only protein 47
• Gene ID: 494188
• mRNA Refseq: NM_001008777
• Protein Refseq: NP_001008777
• MIM: 609498
• UniProt ID: Q5MNV8