Recombinant Human FBXO43 Protein, GST-tagged

Cat.No. : FBXO43-3951H
Product Overview : Human FBXO43 partial ORF ( XP_209918, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Members of the F-box protein family, such as FBXO43, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM, Mar 2008]
Molecular Mass : 37.84 kDa
AA Sequence : MSQRHSGQAGTEAGNGADSPPIVNSKYSTFRDFCSTSSFQDSGYNELKSCSFDNIDKEYLGKKEKGPTLLYEHPETSGLGLTHPLESPTQKKKCILPRKEKDKTPELCET
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FBXO43 F-box protein 43 [ Homo sapiens ]
Official Symbol FBXO43
Synonyms FBXO43; F-box protein 43; F-box only protein 43; Fbx43; early mitotic inhibitor 2; endogenous meiotic inhibitor 2; EMI2; ERP1; FBX43;
Gene ID 286151
mRNA Refseq NM_001029860
Protein Refseq NP_001025031
MIM 609110
UniProt ID Q4G163

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FBXO43 Products

Required fields are marked with *

My Review for All FBXO43 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon