Recombinant Human FBXO43 Protein, GST-tagged
Cat.No. : | FBXO43-3951H |
Product Overview : | Human FBXO43 partial ORF ( XP_209918, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Members of the F-box protein family, such as FBXO43, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM, Mar 2008] |
Molecular Mass : | 37.84 kDa |
AA Sequence : | MSQRHSGQAGTEAGNGADSPPIVNSKYSTFRDFCSTSSFQDSGYNELKSCSFDNIDKEYLGKKEKGPTLLYEHPETSGLGLTHPLESPTQKKKCILPRKEKDKTPELCET |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FBXO43 F-box protein 43 [ Homo sapiens ] |
Official Symbol | FBXO43 |
Synonyms | FBXO43; F-box protein 43; F-box only protein 43; Fbx43; early mitotic inhibitor 2; endogenous meiotic inhibitor 2; EMI2; ERP1; FBX43; |
Gene ID | 286151 |
mRNA Refseq | NM_001029860 |
Protein Refseq | NP_001025031 |
MIM | 609110 |
UniProt ID | Q4G163 |
◆ Recombinant Proteins | ||
FBXO43-10739Z | Recombinant Zebrafish FBXO43 | +Inquiry |
FBXO43-2297R | Recombinant Rat FBXO43 Protein | +Inquiry |
FBXO43-1954R | Recombinant Rat FBXO43 Protein, His (Fc)-Avi-tagged | +Inquiry |
FBXO43-3951H | Recombinant Human FBXO43 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FBXO43 Products
Required fields are marked with *
My Review for All FBXO43 Products
Required fields are marked with *
0
Inquiry Basket