Recombinant Human FBXO43 Protein, GST-tagged

• Cat.No.: FBXO43-3951H
• Product Overview: Human FBXO43 partial ORF ( XP_209918, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Members of the F-box protein family, such as FBXO43, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM, Mar 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 37.84 kDa
• AA Sequence: MSQRHSGQAGTEAGNGADSPPIVNSKYSTFRDFCSTSSFQDSGYNELKSCSFDNIDKEYLGKKEKGPTLLYEHPETSGLGLTHPLESPTQKKKCILPRKEKDKTPELCET
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FBXO43 F-box protein 43 [ Homo sapiens ]
• Official Symbol: FBXO43
• Synonyms: FBXO43; F-box protein 43; F-box only protein 43; Fbx43; early mitotic inhibitor 2; endogenous meiotic inhibitor 2; EMI2; ERP1; FBX43
• Gene ID: 286151
• mRNA Refseq: NM_001029860
• Protein Refseq: NP_001025031
• MIM: 609110
• UniProt ID: Q4G163