Recombinant Human FBXO41 Protein, GST-tagged

• Cat.No.: FBXO41-3948H
• Product Overview: Human FBXO41 partial ORF ( XP_377742.2, 400 a.a. - 498 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the F-box protein family, which is characterized by an approximately 40 amino acid motif, the F-box. F-box proteins constitute one of the four subunits of the SCF ubiquitin protein ligase complex that plays a role in phosphorylation-dependent ubiquitination. F-box proteins are divided into three classes depending on the interaction substrate domain each contains in addition to the F-box motif: FBXW proteins contain WD-40 domains, FBXL proteins contain leucine-rich repeats, and FBXO proteins contain either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the FBXO class. [provided by RefSeq, Feb 2014]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.63 kDa
• AA Sequence: DHVSEITQEVAAEVCREGLKGLEMLVLTATPVTPKALLHFNSICRNLKSIVVQIGIADYFKEPSSPEAQKLFEDMVTKLQALRRRPGFSKILHIKVEGG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FBXO41 F-box protein 41 [ Homo sapiens (human) ]
• Official Symbol: FBXO41
• Synonyms: FBXO41; F-box protein 41; F-Box Protein 41; FBX41; F-Box Only Protein 41; KIAA1940; F-box only protein 41
• Gene ID: 150726
• mRNA Refseq: NM_001080410
• Protein Refseq: NP_001073879
• MIM: 609108
• UniProt ID: Q8TF61