Recombinant Human FBXL22 Protein, GST-tagged

• Cat.No.: FBXL22-3902H
• Product Overview: Human FBXL22 full-length ORF (AAH65833.1, 1 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the F-box protein family. This F-box protein interacts with S-phase kinase-associated protein 1A and cullin in order to form SCF complexes which function as ubiquitin ligases.[provided by RefSeq, Sep 2010]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 52.91 kDa
• AA Sequence: MHITQLNRECLLHLFSFLDKDSRKSLARTCSQLHDVFEDPALWSLLHFRSLTELQKDNFLLGPALRSLSICWHSSRVQVCSIEDWLKSAFQRSICSRHESLVNDFLLRVCDRLSAVRSPRRREAPAPSSGTPIAVGPKSPRWGGPDHSEFADLRSGVTGARAAARRGLGSLRAERPSETPPAPGVSWGPPPPGAPVVISVKQEEGKQGRTGRRSHRAAPPCGFARTRVCPPTFPGADAFPQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FBXL22 F-box and leucine-rich repeat protein 22 [ Homo sapiens ]
• Official Symbol: FBXL22
• Synonyms: FBXL22; F-box and leucine-rich repeat protein 22; F-box/LRR-repeat protein 22; Fbl22; FLJ39626; MGC75496
• Gene ID: 283807
• mRNA Refseq: NM_203373
• Protein Refseq: NP_976307
• MIM: 609088
• UniProt ID: Q6P050