Recombinant Human FBXL22 Protein, GST-tagged

Cat.No. : FBXL22-3902H
Product Overview : Human FBXL22 full-length ORF (AAH65833.1, 1 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the F-box protein family. This F-box protein interacts with S-phase kinase-associated protein 1A and cullin in order to form SCF complexes which function as ubiquitin ligases.[provided by RefSeq, Sep 2010]
Molecular Mass : 52.91 kDa
AA Sequence : MHITQLNRECLLHLFSFLDKDSRKSLARTCSQLHDVFEDPALWSLLHFRSLTELQKDNFLLGPALRSLSICWHSSRVQVCSIEDWLKSAFQRSICSRHESLVNDFLLRVCDRLSAVRSPRRREAPAPSSGTPIAVGPKSPRWGGPDHSEFADLRSGVTGARAAARRGLGSLRAERPSETPPAPGVSWGPPPPGAPVVISVKQEEGKQGRTGRRSHRAAPPCGFARTRVCPPTFPGADAFPQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FBXL22 F-box and leucine-rich repeat protein 22 [ Homo sapiens ]
Official Symbol FBXL22
Synonyms FBXL22; F-box and leucine-rich repeat protein 22; F-box/LRR-repeat protein 22; Fbl22; FLJ39626; MGC75496;
Gene ID 283807
mRNA Refseq NM_203373
Protein Refseq NP_976307
MIM 609088
UniProt ID Q6P050

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FBXL22 Products

Required fields are marked with *

My Review for All FBXL22 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon