Recombinant Human FBXL19 Protein, GST-tagged

Description :	This gene encodes a member of the Skp1-Cullin-F-box family of E3 ubiquitin ligases. The encoded protein is reported to bind to the transmembrane receptor interleukin 1 receptor-like 1 and regulate its ubiquitination and degradation. This protein has been linked to the regulation of pulmonary inflammation and psoriasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	37.62 kDa
AA Sequence :	RLLDLRWIEDVKDSQLRELLLPPPDTKPGQTESRGRLQGVAELRLAGLELTDASLRLLLRHAPQLSALDLSHCAHVGDPSVHLLTAPTSPLRETLVHLNLAGCHRLTD
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	FBXL19 F-box and leucine rich repeat protein 19 [ Homo sapiens (human) ]
Official Symbol	FBXL19
Synonyms	FBXL19; F-box and leucine rich repeat protein 19; F-Box And Leucine Rich Repeat Protein 19; Jumonji C Domain-Containing Histone Demethylase 1C; Fbl19; F-Box And Leucine-Rich Repeat Protein 19; F-Box/LRR-Repeat Protein 19; CXXC11; JHDM1C; F-box/LRR-repeat protein 19; jumonji C domain-containing histone demethylase 1C
Gene ID	54620
mRNA Refseq	NM_001099784
Protein Refseq	NP_001093254
MIM	609085
UniProt ID	Q6PCT2