Recombinant Human FBXL19 Protein, GST-tagged

Cat.No. : FBXL19-3897H
Product Overview : Human FBXL19 partial ORF ( NP_061958.1, 365 a.a. - 472 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the Skp1-Cullin-F-box family of E3 ubiquitin ligases. The encoded protein is reported to bind to the transmembrane receptor interleukin 1 receptor-like 1 and regulate its ubiquitination and degradation. This protein has been linked to the regulation of pulmonary inflammation and psoriasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]
Molecular Mass : 37.62 kDa
AA Sequence : RLLDLRWIEDVKDSQLRELLLPPPDTKPGQTESRGRLQGVAELRLAGLELTDASLRLLLRHAPQLSALDLSHCAHVGDPSVHLLTAPTSPLRETLVHLNLAGCHRLTD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FBXL19 F-box and leucine rich repeat protein 19 [ Homo sapiens (human) ]
Official Symbol FBXL19
Synonyms FBXL19; F-box and leucine rich repeat protein 19; F-Box And Leucine Rich Repeat Protein 19; Jumonji C Domain-Containing Histone Demethylase 1C; Fbl19; F-Box And Leucine-Rich Repeat Protein 19; F-Box/LRR-Repeat Protein 19; CXXC11; JHDM1C; F-box/LRR-repeat protein 19; jumonji C domain-containing histone demethylase 1C
Gene ID 54620
mRNA Refseq NM_001099784
Protein Refseq NP_001093254
MIM 609085
UniProt ID Q6PCT2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FBXL19 Products

Required fields are marked with *

My Review for All FBXL19 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon