Recombinant Human FBRS protein, GST-tagged
Cat.No. : | FBRS-301438H |
Product Overview : | Recombinant Human FBRS (218-290 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Pro218-Ala290 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | PPEAARTPGSDKERPVERREPSITKEEKDRDLPFSRPQLRVSPATPKARAGEEGPRPTKESVRVKEERKEEAA |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | FBRS fibrosin [ Homo sapiens ] |
Official Symbol | FBRS |
Synonyms | FBRS; fibrosin; FBS1, fibrosin 1; probable fibrosin-1; FBS; FLJ11618; fibrosin 1; fibrogenic lymphokine; probable fibrosin-1 long transcript protein; FBS1; |
Gene ID | 64319 |
mRNA Refseq | NM_001105079 |
Protein Refseq | NP_001098549 |
MIM | 608601 |
UniProt ID | Q9HAH7 |
◆ Recombinant Proteins | ||
Fbrs-728M | Recombinant Mouse Fbrs Protein, His-tagged | +Inquiry |
FBRS-301438H | Recombinant Human FBRS protein, GST-tagged | +Inquiry |
FBRS-5709M | Recombinant Mouse FBRS Protein | +Inquiry |
FBRS-3883H | Recombinant Human FBRS Protein, GST-tagged | +Inquiry |
FBRS-4898HF | Recombinant Full Length Human FBRS Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FBRS Products
Required fields are marked with *
My Review for All FBRS Products
Required fields are marked with *
0
Inquiry Basket