Recombinant Human FBP2 protein, GST-tagged

• Cat.No.: FBP2-301626H
• Product Overview: Recombinant Human FBP2 (283-339 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Asn283-Ser339
• AA Sequence: NPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQAGS
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: FBP2 fructose-1,6-bisphosphatase 2 [ Homo sapiens ]
• Official Symbol: FBP2
• Synonyms: FBP2; fructose-1,6-bisphosphatase 2; fructose-1,6-bisphosphatase isozyme 2; FBPase 2; hexosediphosphatase; muscle fructose-bisphosphatase; D-fructose-1,6-bisphosphate 1-phosphohydrolase 2; MGC142192
• Gene ID: 8789
• mRNA Refseq: NM_003837
• Protein Refseq: NP_003828
• MIM: 603027
• UniProt ID: O00757