Recombinant Human FASLG protein(141-280 aa), N-MBP & C-His-tagged

• Cat.No.: FASLG-2767H
• Product Overview: Recombinant Human FASLG protein(P48023)(141-280 aa), fused with N-terminal MBP tag and C-terminal His tag, was expressed in HEK293.

Specification

• Source: HEK293
• Species: Human
• Tag: N-MBP & C-His
• Protein length: 141-280 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: KELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYK
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: FASLG Fas ligand (TNF superfamily, member 6) [ Homo sapiens ]
• Official Symbol: FASLG
• Synonyms: FASLG; Fas ligand (TNF superfamily, member 6); APT1LG1, TNFSF6, tumor necrosis factor (ligand) superfamily, member 6; tumor necrosis factor ligand superfamily member 6; CD178; FasL; APTL; CD95 ligand; fas antigen ligand; apoptosis antigen ligand; apoptosis (APO-1) antigen ligand 1; tumor necrosis factor (ligand) superfamily, member 6; FASL; CD95L; CD95-L; TNFSF6; APT1LG1
• Gene ID: 356
• mRNA Refseq: NM_000639
• Protein Refseq: NP_000630
• MIM: 134638
• UniProt ID: P48023