Recombinant Human FASLG Protein (103-281 aa), His-tagged

• Cat.No.: FASLG-1394H
• Product Overview: Recombinant Human FASLG Protein (103-281 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Apoptosis. Protein Description: Partial.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 103-281 aa
• Description: Cytokine that binds to TNFRSF6/FAS, a receptor that transduces the apoptotic signal into cells. May be involved in cytotoxic T-cell mediated apoptosis and in T-cell development. TNFRSF6/FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. Binding to the decoy receptor TNFRSF6B/DcR3 modulates its effects.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 22.4 kDa
• AA Sequence: QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: FASLG Fas ligand (TNF superfamily, member 6) [ Homo sapiens ]
• Official Symbol: FASLG
• Synonyms: FASLG; CD178; FasL; APTL; CD95 ligand; FASL; CD95L; CD95-L; TNFSF6; APT1LG1
• Gene ID: 356
• mRNA Refseq: NM_000639
• Protein Refseq: NP_000630
• MIM: 134638
• UniProt ID: P48023