Recombinant Human FANK1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: FANK1-2115H
• Product Overview: FANK1 MS Standard C13 and N15-labeled recombinant protein (NP_660278) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Through the activation of JUN and AP-1-mediated transcription, may regulate apoptosis.
• Molecular Mass: 38.4 kDa
• AA Sequence: MEPQRIMPPSKPHPPVVGKVTHHSIELYWDLEKKAKRQGPQEQWFRFSIEEEDPKMHTYGIIYTGYATKHVVEGLEPRTLYRFRLKVTSPSGECEYSPLVSVSTTREPISSEHLHRAVSVNDEDLLVRILQGGRVKVDVPNKFGFTALMVAAQKGYTRLVKILVSNGTDVNLKNGSGKDSLMLACYAGHLDVVKYLRRHGASWQARDLGGCTALHWAADGGHCSVIEWMIKDGCEVDVVDTGSGWTPLMRVSAVSGNQRVASLLIDAGANVNVKDRNGKTPLMVAVLNNHEELVQLLLDKGADASVKNEFGKGVLEMARVFDRQSVVSLLEERKKKQRPKKSCVCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: FANK1 fibronectin type III and ankyrin repeat domains 1 [ Homo sapiens (human) ]
• Official Symbol: FANK1
• Synonyms: FANK1; fibronectin type III and ankyrin repeat domains 1; fibronectin type 3 and ankyrin repeat domains 1; fibronectin type 3 and ankyrin repeat domains protein 1; 1700007B22Rik; HSD13
• Gene ID: 92565
• mRNA Refseq: NM_145235
• Protein Refseq: NP_660278
• MIM: 611640
• UniProt ID: Q8TC84