Recombinant Human FAM76A Protein, GST-tagged

• Cat.No.: FAM76A-3800H
• Product Overview: Human FAM76A full-length ORF ( NP_689873.1, 1 a.a. - 307 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: FAM76A (Family With Sequence Similarity 76 Member A) is a Protein Coding gene. An important paralog of this gene is FAM76B.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 61.4 kDa
• AA Sequence: MAALYACTKCHQRFPFEALSQGQQLCKECRIAHPVVKCTYCRTEYQQESKTNTICKKCAQNVQLYGTPKPCQYCNIIAAFIGNKCQRCTNSEKKYGPPYSCEQCKQQCAFDRKDDRKKVDGKLLCWLCTLSYKRVLQKTKEQRKHLSSSSRAGHQEKEQYSRLSGGGHYNSQKTLSTSSIQNEIPKKKSKFESITTNGDSFSPDLALDSPGTDHFVIIAQLKEEVATLKKMLHQKDQMILEKEKKITELKADFQYQESQMRAKMNQMEKTHKEVTEQLQAKNRELLKQAAALSKSKKSEKSGAITSP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM76A family with sequence similarity 76, member A [ Homo sapiens ]
• Official Symbol: FAM76A
• Synonyms: FAM76A; family with sequence similarity 76, member A; protein FAM76A; MGC34648; RP3-426I6.1; FLJ41946
• Gene ID: 199870
• mRNA Refseq: NM_001143912
• Protein Refseq: NP_001137384
• UniProt ID: Q8TAV0