Recombinant Human FAM71C Protein, GST-tagged

• Cat.No.: FAM71C-3793H
• Product Overview: Human FAM71C full-length ORF ( NP_699195.1, 1 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: FAM71C (Family With Sequence Similarity 71 Member C) is a Protein Coding gene. An important paralog of this gene is FAM71A.
• Molecular Mass: 53.9 kDa
• AA Sequence: MEDCCMLPYYTAQSSPAMGMFNTSMGKLQRQLYKGEYTIFRYAPMFESDFIQISKRGEVIDVHNRARMVTMGIVRTSPCLTLPDVMLLARPAAVCDNARCGPATQKRESPPAEILELTRLLPLMFVKITIHNSVKKQLHLKLATGRSFYLQLCPPSDASEDLFVHWENLVYILRPPVEAYSDTRAILAGNTLDSSVLEEVQRSPVGYAMKFCEEKEQFRISRLHMNAEMFGSTYCDYTIEI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM71C family with sequence similarity 71, member C [ Homo sapiens ]
• Official Symbol: FAM71C
• Synonyms: FAM71C; family with sequence similarity 71, member C; Family With Sequence Similarity 71 Member C; Family With Sequence Similarity 71, Member C
• Gene ID: 196472
• mRNA Refseq: NM_153364
• Protein Refseq: NP_699195
• UniProt ID: Q8NEG0