Recombinant Human FAM60A Protein, GST-tagged

• Cat.No.: FAM60A-3785H
• Product Overview: Human FAM60A full-length ORF ( NP_067061.1, 1 a.a. - 221 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: FAM60A (Family With Sequence Similarity 60 Member A) is a Protein Coding gene.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 51.3 kDa
• AA Sequence: MFGFHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIKSNQISKLQKEFKRHNSDAHSTTSSASPAQSPCYSNQSDDGSDTEMASGSNRTPVFSFLDLTYWKRQKICCGIIYKGRFGEVLIDTHLFKPCCSNKKAAAEKPEEQGPEPLPISTQEW
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM60A family with sequence similarity 60, member A [ Homo sapiens ]
• Official Symbol: FAM60A
• Synonyms: family with sequence similarity 60, member A; 30702; Ensembl:ENSG00000139146; protein FAM60A;tera protein homolog; L4; TERA; C12orf14
• Gene ID: 58516
• mRNA Refseq: NM_001135811
• Protein Refseq: NP_001129283
• MIM: 615027
• UniProt ID: Q9NP50