Recombinant Full Length Human FAM3D Protein, GST-tagged
Cat.No. : | FAM3D-4588HF |
Product Overview : | Human FAM3D full-length ORF ( AAH15359, 26 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 26-224 amino acids |
Description : | FAM3D (Family With Sequence Similarity 3 Member D) is a Protein Coding gene. Diseases associated with FAM3D include Narcolepsy. GO annotations related to this gene include cytokine activity. An important paralog of this gene is FAM3A. |
Molecular Mass : | 47.63 kDa |
AA Sequence : | YMSFSMKTIRLPRWLAASPTKEIQVKKYKCGLIKPCPANYFAFKICSGAANVVGPTLCFEDRMIMSPVKNNVGRGLNIALVNGTTGAVLGQKAFDMYSGDVMHLVKFLKEIPGGALVLVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWVFIGAKDLRGKSPFEQFLKNSPDTNKYEGWPELLEMEGCMPPKPF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM3D family with sequence similarity 3, member D [ Homo sapiens ] |
Official Symbol | FAM3D |
Synonyms | FAM3D; family with sequence similarity 3, member D; protein FAM3D; EF7; OIT1; cytokine-like protein EF-7; |
Gene ID | 131177 |
mRNA Refseq | NM_138805 |
Protein Refseq | NP_620160 |
MIM | 608619 |
UniProt ID | Q96BQ1 |
◆ Recombinant Proteins | ||
FAM3D-3922H | Recombinant Human FAM3D protein(Met1-Phe224), His-tagged | +Inquiry |
FAM3D-1775H | Recombinant Human FAM3D protein, His & T7-tagged | +Inquiry |
FAM3D-6743H | Recombinant Human FAM3D protein, hFc-tagged | +Inquiry |
FAM3D-3756H | Recombinant Human FAM3D Protein, GST-tagged | +Inquiry |
FAM3D-3755H | Recombinant Human FAM3D Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM3D-1947HCL | Recombinant Human FAM3D cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAM3D Products
Required fields are marked with *
My Review for All FAM3D Products
Required fields are marked with *
0
Inquiry Basket