Recombinant Human FAM3C, His-tagged

• Cat.No.: FAM3C-27929TH
• Product Overview: Recombinant full length Human FAM3C with N terminal His tag; 224 amino acids including tag; Predicted MWt 24.5 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 203 amino acids
• Description: This gene is a member of the family with sequence similarity 3 (FAM3) family and encodes a secreted protein with a GG domain. A change in expression of this protein has been noted in pancreatic cancer-derived cells.
• Conjugation: HIS
• Molecular Weight: 24.500kDa inclusive of tags
• Tissue specificity: Present in most secretory epithelia (at protein level).
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 0.08% DTT, 20% Glycerol, 1.17% Sodium chloride
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMQVFEIKMDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFAFKMASGAANVVGPKICLEDNVLMSGVKNNVGRGINVALANGKTGEVLDTKYFDMWGGDVAPFIEFLKAIQDGTIVLMGTYDDGATKLNDEARRLIADLGSTSITNLGFRDNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD
• Sequence Similarities: Belongs to the FAM3 family.

Gene Information

• Gene Name: FAM3C family with sequence similarity 3, member C [ Homo sapiens ]
• Official Symbol: FAM3C
• Synonyms: FAM3C; family with sequence similarity 3, member C; protein FAM3C; GS3876; ILEI; interleukin like EMT inducer; predicted osteoblast protein
• Gene ID: 10447
• mRNA Refseq: NM_001040020
• Protein Refseq: NP_001035109
• MIM: 608618
• Uniprot ID: Q92520
• Chromosome Location: 7q22.1-q31.1
• Function: cytokine activity