Recombinant Human FAM3C, His-tagged

Cat.No. : FAM3C-27929TH
Product Overview : Recombinant full length Human FAM3C with N terminal His tag; 224 amino acids including tag; Predicted MWt 24.5 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 203 amino acids
Description : This gene is a member of the family with sequence similarity 3 (FAM3) family and encodes a secreted protein with a GG domain. A change in expression of this protein has been noted in pancreatic cancer-derived cells.
Conjugation : HIS
Molecular Weight : 24.500kDa inclusive of tags
Tissue specificity : Present in most secretory epithelia (at protein level).
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 0.08% DTT, 20% Glycerol, 1.17% Sodium chloride
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMQVFEIKMDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFAFKMASGAANVVGPKICLEDNVLMSGVKNNVGRGINVALANGKTGEVLDTKYFDMWGGDVAPFIEFLKAIQDGTIVLMGTYDDGATKLNDEARRLIADLGSTSITNLGFRDNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD
Sequence Similarities : Belongs to the FAM3 family.
Gene Name FAM3C family with sequence similarity 3, member C [ Homo sapiens ]
Official Symbol FAM3C
Synonyms FAM3C; family with sequence similarity 3, member C; protein FAM3C; GS3876; ILEI; interleukin like EMT inducer; predicted osteoblast protein;
Gene ID 10447
mRNA Refseq NM_001040020
Protein Refseq NP_001035109
MIM 608618
Uniprot ID Q92520
Chromosome Location 7q22.1-q31.1
Function cytokine activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FAM3C Products

Required fields are marked with *

My Review for All FAM3C Products

Required fields are marked with *

0

Inquiry Basket

cartIcon