Recombinant Human FAM3B Protein, Fc-tagged
Cat.No. : | FAM3B-750H |
Product Overview : | Recombinant human FAM3B protein with Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 235 |
Description : | Involved in insulin secretion. Located in extracellular exosome. |
Form : | Lyophilized |
Molecular Mass : | 49.5 kDa |
AA Sequence : | MRPLAGGLLKVVFVVFASLCAWYSGYLLAELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | FAM3B family with sequence similarity 3, member B [ Homo sapiens (human) ] |
Official Symbol | FAM3B |
Synonyms | FAM3B; family with sequence similarity 3, member B; C21orf11, chromosome 21 open reading frame 11; protein FAM3B; 2 21; C21orf76; D21M16SJHU19e; ORF9; PRED44; pancreatic derived factor; pancreatic-derived factor; cytokine-like protein 2-21; 2-21; PANDER; C21orf11; |
Gene ID | 54097 |
mRNA Refseq | NM_058186 |
Protein Refseq | NP_478066 |
MIM | 608617 |
UniProt ID | P58499 |
◆ Recombinant Proteins | ||
FAM3B-750H | Recombinant Human FAM3B Protein, Fc-tagged | +Inquiry |
Fam3b-6444M | Recombinant Mouse Fam3b protein, His-tagged | +Inquiry |
Fam3b-4247M | Recombinant Mouse Fam3b protein, His&Myc-tagged | +Inquiry |
Fam3b-4746M | Recombinant Mouse Fam3b protein(30-235aa), His&Myc-tagged | +Inquiry |
FAM3B-3657H | Recombinant Human FAM3B Protein (Glu30-Ser187), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM3B-1648HCL | Recombinant Human FAM3B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAM3B Products
Required fields are marked with *
My Review for All FAM3B Products
Required fields are marked with *
0
Inquiry Basket