Recombinant Human FAM38B protein, GST-tagged

• Cat.No.: FAM38B-301415H
• Product Overview: Recombinant Human FAM38B (306-401 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Lys306-Asn401
• AA Sequence: KQKMIHELLDPNSSFSVVFSWSIQRNLSLGAKSEIATDKLSFPLKNITRKNIAKMIAGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSEN
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: PIEZO2 piezo type mechanosensitive ion channel component 2 [ Homo sapiens (human) ]
• Official Symbol: FAM38B
• Synonyms: DA3; DA5; MWKS; DAIPT; PIEZO2; HsT748; HsT771; FAM38B2; C18orf30; C18orf58
• Gene ID: 63895
• mRNA Refseq: NM_001378183
• Protein Refseq: NP_001365112
• MIM: 613629