Recombinant Human FAM32A Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: FAM32A-3202H
• Product Overview: FAM32A MS Standard C13 and N15-labeled recombinant protein (NP_054796) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Isoform 1, but not isoform 2 or isoform 3, may induce G2 arrest and apoptosis. May also increase cell sensitivity to apoptotic stimuli.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 13.2 kDa
• AA Sequence: MEAYEQVQKGPLKLKGVAELGVTKRKKKKKDKDKAKLLEAMGTSKKNEEEKRRGLDKRTPAQAAFEKMQEKRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: FAM32A family with sequence similarity 32 member A [ Homo sapiens (human) ]
• Official Symbol: FAM32A
• Synonyms: FAM32A; family with sequence similarity 32, member A; protein FAM32A; DKFZP586O0120; ovarian tumor associated gene-12; OTAG12
• Gene ID: 26017
• mRNA Refseq: NM_014077
• Protein Refseq: NP_054796
• MIM: 614554
• UniProt ID: Q9Y421