Recombinant Human FAM32A Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : FAM32A-3202H
Product Overview : FAM32A MS Standard C13 and N15-labeled recombinant protein (NP_054796) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Isoform 1, but not isoform 2 or isoform 3, may induce G2 arrest and apoptosis. May also increase cell sensitivity to apoptotic stimuli.
Molecular Mass : 13.2 kDa
AA Sequence : MEAYEQVQKGPLKLKGVAELGVTKRKKKKKDKDKAKLLEAMGTSKKNEEEKRRGLDKRTPAQAAFEKMQEKRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name FAM32A family with sequence similarity 32 member A [ Homo sapiens (human) ]
Official Symbol FAM32A
Synonyms FAM32A; family with sequence similarity 32, member A; protein FAM32A; DKFZP586O0120; ovarian tumor associated gene-12; OTAG12;
Gene ID 26017
mRNA Refseq NM_014077
Protein Refseq NP_054796
MIM 614554
UniProt ID Q9Y421

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FAM32A Products

Required fields are marked with *

My Review for All FAM32A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon