Recombinant Human FAM229B Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: FAM229B-2066H
• Product Overview: C6orf225 MS Standard C13 and N15-labeled recombinant protein (NP_001028736) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: FAM229B (Family With Sequence Similarity 229 Member B) is a Protein Coding gene. An important paralog of this gene is FAM229A.
• Molecular Mass: 8.7 kDa
• AA Sequence: MPFQFGTQPRRFPVEGGDSSIELEPGLSSSAACNGKEMSPTRQLRRCPGSHCLTITDVPVTVYATTRKPPAQSSKEMHPKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: FAM229B family with sequence similarity 229 member B [ Homo sapiens (human) ]
• Official Symbol: FAM229B
• Synonyms: FAM229B; family with sequence similarity 229 member B; C6orf225; protein FAM229B; UPF0731 protein C6orf225
• Gene ID: 619208
• mRNA Refseq: NM_001033564
• Protein Refseq: NP_001028736
• UniProt ID: Q4G0N7