Recombinant Human FAM20C, GST-tagged
Cat.No. : | FAM20C-203H |
Product Overview : | Recombinant Human FAM20C(1 a.a. - 570 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the family of secreted protein kinases. The encoded protein binds calcium and phosphorylates proteins involved in bone mineralization. Mutations in this gene are associated with the autosomal recessive disorder Raine syndrome. |
Molecular Mass : | 89.1 kDa |
AA Sequence : | MVFLVACALHIALDLLPRLERRGARPSGEPGCSCAQPAAEVAAPGWAQVRGRPGEPPAASSAAGDAGWPNKHTLR ILQDFSSDPSSNLSSHSLEKLPPAAEPAERALRGRDPGALRPHDPAHRPLLRDPGPRRSESPPGPGGDASLLARL FEHPLYRVAVPPLTEEDVLFNVNSDTRLSPKAAENPDWPHAGAEGAEFLSPGEAAVDSYPNWLKFHIGINRYELY SRHNPAIEALLHDLSSQRITSVAMKSGGTQLKLIMTFQNYGQALFKPMKQTREQETPPDFFYFSDYERHNAEIAA FHLDRILDFRRVPPVAGRMVNMTKEIRDVTRDKKLWRTFFISPANNICFYGECSYYCSTEHALCGKPDQIEGSLA AFLPDLSLAKRKTWRNPWRRSYHKRKKAEWEVDPDYCEEVKQTPPYDSSHRILDVMDMTIFDFLMGNMDRHHYET FEKFGNETFIIHLDNGRGFGKYSHDELSILVPLQQCCRIRKSTYLRLQLLAKEEYKLSLLMAESLRGDQVAPVLY QPHLEALDRRLRVVLKAVRDCVERNGLHSVVDDDLDTEHRAASAR |
Applications : | ELISA; WB-Re; AP; Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FAM20C family with sequence similarity 20, member C [ Homo sapiens (human) ] |
Official Symbol | FAM20C |
Synonyms | FAM20C; family with sequence similarity 20, member C; dentin matrix protein 4; DKFZp547D065; DMP4; IMAGE:4942737; RNS; DMP-4; GEF-CK; extracellular serine/threonine protein kinase FAM20C; dentin matrix protein 4; golgi-enriched fraction casein kinase; NP_064608.2; EC 2.7.11.1 |
Gene ID | 56975 |
mRNA Refseq | NM_020223 |
Protein Refseq | NP_064608 |
MIM | 611061 |
UniProt ID | Q8IXL6 |
Chromosome Location | 7p22.3 |
Function | calcium ion binding; protein serine/threonine kinase activity |
◆ Recombinant Proteins | ||
FAM20C-260H | Active Recombinant Human FAM20C protein, His-tagged | +Inquiry |
FAM20C-1603R | Recombinant Rhesus monkey FAM20C Protein, His-tagged | +Inquiry |
FAM20C-5120H | Recombinant Human FAM20C protein, His&Myc-tagged | +Inquiry |
FAM20C-26375TH | Recombinant Human FAM20C, His-tagged | +Inquiry |
FAM20C-3048M | Recombinant Mouse FAM20C Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAM20C Products
Required fields are marked with *
My Review for All FAM20C Products
Required fields are marked with *
0
Inquiry Basket