Recombinant Human FAM20C, His-tagged
Cat.No. : | FAM20C-26375TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 509-570 of Human FAM20C with a N terminal His tag; predicted MWt 17kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 509-570 a.a. |
Conjugation : | HIS |
Tissue specificity : | Widely expressed. |
Form : | Lyophilised:Reconstitute with 112 μl distilled water. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LLMAESLRGDQVAPVLYQPHLEALDRRLRVVLKAVRDCVE RDGLHSVVDDDLDTEHRAASAR |
Sequence Similarities : | Belongs to the FAM20 family. |
Gene Name | FAM20C family with sequence similarity 20, member C [ Homo sapiens ] |
Official Symbol | FAM20C |
Synonyms | FAM20C; family with sequence similarity 20, member C; dentin matrix protein 4; DKFZp547D065; DMP4; IMAGE:4942737; |
Gene ID | 56975 |
mRNA Refseq | NM_020223 |
Protein Refseq | NP_064608 |
MIM | 611061 |
Uniprot ID | Q8IXL6 |
Chromosome Location | 7p22.3 |
◆ Recombinant Proteins | ||
FAM20C-26H | Recombinant Human FAM20C protein, His-tagged | +Inquiry |
FAM20C-5120H | Recombinant Human FAM20C protein, His&Myc-tagged | +Inquiry |
FAM20C-5926H | Recombinant Human FAM20C protein, His&Myc-tagged | +Inquiry |
Fam20c-2310M | Recombinant Mouse Fam20c protein, His&Myc-tagged | +Inquiry |
FAM20C-1603R | Recombinant Rhesus monkey FAM20C Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAM20C Products
Required fields are marked with *
My Review for All FAM20C Products
Required fields are marked with *
0
Inquiry Basket