Recombinant Human FAM206A Protein, GST-tagged

• Cat.No.: FAM206A-4260H
• Product Overview: Human FLJ20457 full-length ORF ( AAH15795, 1 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: FAM206A (Family With Sequence Similarity 206 Member A) is a Protein Coding gene. Diseases associated with FAM206A include Peroxisome Biogenesis Disorder 1B.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 45.65 kDa
• AA Sequence: MATEPEAAEPVVPSLVDRYFTRWYKPDVKGKFCEDHCILQHSNRICVITLAESHPVLQSGKTIKSISYQISTNCSRLQNKVSGKFKRGAQFLTELAPLCKIYCSDGEEYTVSSCVRGRLMEVNENILHKPSILQEKPSTEGYIAVVLPKFEESKSITEGLLTQKQYEEVMVKRINATTATS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM206A family with sequence similarity 206 member A [ Homo sapiens (human) ]
• Official Symbol: FAM206A
• Synonyms: FAM206A; family with sequence similarity 206 member A; CG-8; C9orf6; Simiate; protein Simiate; protein FAM206A
• Gene ID: 54942
• mRNA Refseq: NM_017832
• Protein Refseq: NP_060302
• UniProt ID: Q9NX38