Recombinant Human FAM19A5 Protein, GST-tagged

• Cat.No.: FAM19A5-3733H
• Product Overview: Human FAM19A5 full-length ORF (BAG53905.1, 1 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the CC-chemokine family. The TAFA proteins are predominantly expressed in specific regions of the brain, and are postulated to function as brain-specific chemokines or neurokines that act as regulators of immune and nervous cells. [provided by RefSeq, Sep 2013]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 40 kDa
• AA Sequence: MQLLKALWALAGAALCCFLVLVIHAQFLKEGQLAAGTCEIVTLDRDSSQPRRTIARQTARCACRKGQIAGTTRARPACVDARIIKTKQWCDMLPCLEGEGCDLLINRSGWTCTQPGGRIKTTTVS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM19A5 family with sequence similarity 19 member A5, C-C motif chemokine like [ Homo sapiens (human) ]
• Official Symbol: FAM19A5
• Synonyms: FAM19A5; family with sequence similarity 19 member A5, C-C motif chemokine like; Family With Sequence Similarity 19 Member A5, C-C Motif Chemokine Like; Family With Sequence Similarity 19 (Chemokine (C-C Motif)-Like), Member A5; Chemokine-Like Protein TAFA-5; TAFA5; Protein FAM19A5; TAFA Protein 5; QLLK5208; UNQ5208; TAFA-5; protein FAM19A5; TAFA protein 5; chemokine-like protein TAFA-5; family with sequence similarity 19 (chemokine (C-C motif)-like), member A5
• Gene ID: 25817
• mRNA Refseq: NM_001082967
• Protein Refseq: NP_001076436
• MIM: 617499
• UniProt ID: Q7Z5A7