Recombinant Human FAM19A4 Protein, HIS-tagged

• Cat.No.: FAM19A4-164H
• Product Overview: Recombinant Human FAM19A4, transcript variant 1, fused with His tag at N-terminal was expressed in E. coli.

Specification

• Description: This gene is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the CC-chemokine family. The TAFA proteins are predominantly expressed in specific regions of the brain, and are postulated to function as brain-specific chemokines or neurokines, that act as regulators of immune and nervous cells. Alternatively spliced transcript variants have been observed for this gene.
• Source: E. coli
• Tag: HIS
• Form: Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH7.4
• Molecular Mass: 14.1kD
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMSSQHLRGHAGHHQIKQGTCEVVAVHRCCNKNRIEERSQTVKCSCFPGQVAGTTRAQPSCVEASIVIQKWWCHMNPCLEGEDCKVLPDYSGWSCSSGNKVKTTKVTR
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: FAM19A4 family with sequence similarity 19 (chemokine (C-C motif)-like), member A4 [ Homo sapiens ]
• Official Symbol: FAM19A4
• Synonyms: FAM19A4; family with sequence similarity 19 (chemokine (C-C motif)-like), member A4; protein FAM19A4; TAFA 4; chemokine-like protein TAFA-4; TAFA4; TAFA-4; FLJ25161
• Gene ID: 151647
• mRNA Refseq: NM_001005527
• Protein Refseq: NP_001005527
• UniProt ID: Q96LR4