Recombinant Full Length Human FAM19A4 Protein, GST-tagged

• Cat.No.: FAM19A4-4545HF
• Product Overview: Human FAM19A4 full-length ORF ( NP_001005527.1, 1 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the CC-chemokine family. The TAFA proteins are predominantly expressed in specific regions of the brain, and are postulated to function as brain-specific chemokines or neurokines, that act as regulators of immune and nervous cells. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Nov 2011]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 42.1 kDa
• Protein length: 140 amino acids
• AA Sequence: MRSPRMRVCAKSVLLSHWLFLAYVLMVCCKLMSASSQHLRGHAGHHQIKQGTCEVVAVHRCCNKNRIEERSQTVKCSCFPGQVAGTTRAQPSCVEASIVIQKWWCHMNPCLEGEDCKVLPDYSGWSCSSGNKVKTTKVTR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM19A4 family with sequence similarity 19 (chemokine (C-C motif)-like), member A4 [ Homo sapiens ]
• Official Symbol: FAM19A4
• Synonyms: FAM19A4; family with sequence similarity 19 (chemokine (C-C motif)-like), member A4; protein FAM19A4; TAFA 4; chemokine-like protein TAFA-4; TAFA4; TAFA-4; FLJ25161
• Gene ID: 151647
• mRNA Refseq: NM_001005527
• Protein Refseq: NP_001005527
• MIM: 617498
• UniProt ID: Q96LR4