Recombinant Human FAM181A Protein, GST-tagged

Cat.No. : FAM181A-3725H
Product Overview : Human FAM181A full-length ORF ( AAH09073.1, 1 a.a. - 292 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : FAM181A (Family With Sequence Similarity 181 Member A) is a Protein Coding gene.
Molecular Mass : 58.5 kDa
AA Sequence : MASDSDVKMLLNFVNLASSDIKAALDKSAPCRRSVDHRKYLQKQLKRFSQKYSRLPRGLPGRAAEPYLKRGSEDRPRRLLLDLGPDSSPGGGGGCKEKVLRNPYREECLAKEQLPQRQHPEAAQPGQVPMRKRQLPASFWEEPRPTHSYHVGLEGGLGPREGPPYEGKKNCKGLEPLGPETTLVSMSPRALAEKEPLKMPGVSLVGRVNAWSCCPFQYHGQPIYPGPLGALPQSPVPSLGLWRKSPAFPGELAHLCKDVDGLGQKVCRPVVLKPIPTKPAVPPPIFNVFGYL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM181A family with sequence similarity 181, member A [ Homo sapiens ]
Official Symbol FAM181A
Synonyms C14orf152; FAM181A; family with sequence similarity 181, member A; Family With Sequence Similarity 181 Member A; Family With Sequence Similarity 181, Member A; Chromosome 14 Open Reading Frame 152; Protein FAM181A
Gene ID 90050
mRNA Refseq NM_138344
Protein Refseq NP_612353
UniProt ID Q8N9Y4

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FAM181A Products

Required fields are marked with *

My Review for All FAM181A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon