Recombinant Human FAM177B Protein, GST-tagged

• Cat.No.: FAM177B-3724H
• Product Overview: Human FAM177B full-length ORF (BAC86182.1, 1 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: FAM177B (Family With Sequence Similarity 177 Member B) is a Protein Coding gene. An important paralog of this gene is FAM177A1.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 39.6 kDa
• AA Sequence: MEIDGFQQLDLEKSVPSKKTTPKRIIHFVDGDIMEEYSTEEEEEEEKEEQSTNSTLDPSKLSWGPYLRFWAGRIASTSFSMLSLQATLLLKAEKEGLKQLLRSLSGCMEEFLMWVLVTLD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM177B family with sequence similarity 177 member B [ Homo sapiens (human) ]
• Official Symbol: FAM177B
• Synonyms: FAM177B; family with sequence similarity 177 member B; Family With Sequence Similarity 177 Member B; Family With Sequence Similarity 177, Member B; protein FAM177B
• Gene ID: 400823
• mRNA Refseq: NM_001324080
• Protein Refseq: NP_001311009
• UniProt ID: A6PVY3