Recombinant Human FAM167A Protein, GST-tagged

• Cat.No.: FAM167A-3721H
• Product Overview: Human FAM167A full-length ORF ( AAI04043.1, 1 a.a. - 214 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: FAM167A (Family With Sequence Similarity 167 Member A) is a Protein Coding gene. Diseases associated with FAM167A include Keratolytic Winter Erythema. An important paralog of this gene is FAM167B.
• Molecular Mass: 50.6 kDa
• AA Sequence: MSVPQIHVEEVGAEEGAGAAAPPDDHLRSLKALTEKLRLETRRPSYLEWQARLEEQTWPFPRPAAEPQASLEEGERGGQEPLLPLREAGQHPPSARSASQGARPLSSGKLEGFQSIDEAIAWLRKELTEMRLQDQQLARQLMRLRGDINKLKIEHTCRLHRRMLNDATYELEERDELADLFCDSPLASSFSLSTPLKLIGVTKMNINSRRFSLC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM167A family with sequence similarity 167, member A [ Homo sapiens ]
• Official Symbol: FAM167A
• Synonyms: FAM167A; family with sequence similarity 167, member A; C8orf13, chromosome 8 open reading frame 13; protein FAM167A; D8S265; C8orf13; MGC120649; MGC120650; MGC120651; DKFZp761G151
• Gene ID: 83648
• mRNA Refseq: NM_053279
• Protein Refseq: NP_444509
• MIM: 610085
• UniProt ID: Q96KS9