Recombinant Human FAM13A Protein, GST-tagged

Cat.No. : FAM13A-3709H
Product Overview : Human FAM13A1 full-length ORF ( AAH63126.1, 1 a.a. - 202 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : FAM13A (Family With Sequence Similarity 13 Member A) is a Protein Coding gene. Diseases associated with FAM13A include Pulmonary Fibrosis, Idiopathic. Among its related pathways are Signaling by GPCR and p75 NTR receptor-mediated signalling. GO annotations related to this gene include GTPase activator activity. An important paralog of this gene is FAM13B.
Molecular Mass : 49.1 kDa
AA Sequence : MGAGALAICQSKAAVRLKEDMKKIVAVPLNEQKDFTYQKLFGVSLQELERQGLTENGIPAVVWNIVEYLTQHGLTQEGLFRVNGNVKVVEQLRLKFESGVPVELGKDGDVCSAASLLKLFLRELPDSLITSALQPRFIQLFQDGRNDVQESSLRDLIKELPDTHYCLLKYLCQFLTKVAKHHVQNRMNVHNLATVFGPNCFQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM13A family with sequence similarity 13 member A [ Homo sapiens (human) ]
Official Symbol FAM13A
Synonyms FAM13A; family with sequence similarity 13 member A; Family With Sequence Similarity 13 Member A; Family With Sequence Similarity 13, Member A1; FAM13A1; Family With Sequence Similarity 13, Member A; FAM13A1_v2 Protein; Protein FAM13A; ARHGAP48; KIAA0914; protein FAM13A; FAM13A1_v2 protein; family with sequence similarity 13, member A1
Gene ID 10144
mRNA Refseq NM_001015045
Protein Refseq NP_001015045
MIM 613299
UniProt ID O94988

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FAM13A Products

Required fields are marked with *

My Review for All FAM13A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon