Recombinant Human FAM13A Protein, GST-tagged

• Cat.No.: FAM13A-3709H
• Product Overview: Human FAM13A1 full-length ORF ( AAH63126.1, 1 a.a. - 202 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: FAM13A (Family With Sequence Similarity 13 Member A) is a Protein Coding gene. Diseases associated with FAM13A include Pulmonary Fibrosis, Idiopathic. Among its related pathways are Signaling by GPCR and p75 NTR receptor-mediated signalling. GO annotations related to this gene include GTPase activator activity. An important paralog of this gene is FAM13B.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 49.1 kDa
• AA Sequence: MGAGALAICQSKAAVRLKEDMKKIVAVPLNEQKDFTYQKLFGVSLQELERQGLTENGIPAVVWNIVEYLTQHGLTQEGLFRVNGNVKVVEQLRLKFESGVPVELGKDGDVCSAASLLKLFLRELPDSLITSALQPRFIQLFQDGRNDVQESSLRDLIKELPDTHYCLLKYLCQFLTKVAKHHVQNRMNVHNLATVFGPNCFQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM13A family with sequence similarity 13 member A [ Homo sapiens (human) ]
• Official Symbol: FAM13A
• Synonyms: FAM13A; family with sequence similarity 13 member A; Family With Sequence Similarity 13 Member A; Family With Sequence Similarity 13, Member A1; FAM13A1; Family With Sequence Similarity 13, Member A; FAM13A1_v2 Protein; Protein FAM13A; ARHGAP48; KIAA0914; protein FAM13A; FAM13A1_v2 protein; family with sequence similarity 13, member A1
• Gene ID: 10144
• mRNA Refseq: NM_001015045
• Protein Refseq: NP_001015045
• MIM: 613299
• UniProt ID: O94988