Recombinant Human FAM124A Protein, GST-tagged

• Cat.No.: FAM124A-3692H
• Product Overview: Human FAM124A full-length ORF ( AAH34497.1, 1 a.a. - 288 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: FAM124A (Family With Sequence Similarity 124 Member A) is a Protein Coding gene. An important paralog of this gene is FAM124B.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 59 kDa
• AA Sequence: MDPKAGGGGEEDDCVDSGAETGGSDYSHLSSTSSELSVEEAQDPFLVSIHIIADPGESQPLQEAIDNVLAWIHPDLPLFRVSERRASRRRRKPPKGAQPALAVVLFLQEEYGEEQILQLHRTLQQPPWRHHHTEQVHGRFLPYLPCSQDFFTLAPGTPLWAIRPVHYGKEIVRFTVYCRYDNYADSLRFYQLILRRSPSQKKADFCIFPIFSNLDVDIQFSLKRLPCDQCPVPTDSSVLEFRVRDIGELVPLLPNPCSPISEGRWQTEDHDGNKILLQVLGGRLSLSV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM124A family with sequence similarity 124A [ Homo sapiens ]
• Official Symbol: FAM124A
• Synonyms: FAM124A; family with sequence similarity 124A; protein FAM124A; FLJ30707; FLJ32081
• Gene ID: 220108
• mRNA Refseq: NM_001242312
• Protein Refseq: NP_001229241
• UniProt ID: Q86V42